Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs

2.73 Rating by CuteStat

This website is a sub-domain of elitemarketingpro.com. It has a global traffic rank of #96429 in the world. This website is estimated worth of $ 86,400.00 and have a daily income of around $ 120.00. As no active threats were reported recently by users, miguelisaac.elitemarketingpro.com is SAFE to browse.

PageSpeed Score
64
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 9,978
Daily Pageviews: 59,868

Estimated Valuation

Income Per Day: $ 120.00
Estimated Worth: $ 86,400.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 96,429
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

45.33.23.182

Hosted Country:

United States of America US

Location Latitude:

32.7787

Location Longitude:

-96.8217

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 2
H3 Headings: 1 H4 Headings: 2
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 10
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 45.33.23.182)

Attraction Marketing – Attraction Marketing

- attractionmarketing.com
Not Applicable $ 8.95

Elite Marketing Pro | Welcome

- seanlynnwyman.elitemarketingpro.com

Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs

92,015 $ 90,000.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 01 Jun 2017 06:57:49 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Access-Control-Allow-Origin: *
P3P: CP="NOI"
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: <http://elitemarketingpro.com/wp-json/>; rel="https://api.w.org/", <http://elitemarketingpro.com/>; rel=shortlink
Vary: Accept-Encoding
Last-Modified: Thu, 01 Jun 2017 06:57:49 GMT
Server: cloudflare-nginx
CF-RAY: 368047e046b45ebe-TPA
Content-Encoding: gzip

DNS Record Analysis

Host Type TTL Extra
miguelisaac.elitemarketingpro.com A 299 IP: 45.33.23.182

Similarly Ranked Websites

Access Denied

- pcso.gov.ph
96,431 $ 185,040.00

Automattic Design – Design at Automattic: Be Free

- wiciokrzewkamczacki.design.blog

Design at Automattic: Be Free

96,431 $ 150,480.00

Real Estate Exam Prep - PrepAgent.com

- prepagent.com

Pass your real estate exam with PrepAgent's online practice tests, animated videos, live online webinars, audio lessons, online flashcards, and more.

96,431 $ 185,040.00

Bollywood Hub |

- bollywoodmasalla.com
96,432 $ 86,400.00